PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_04535D371.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 285aa    MW: 30357 Da    PI: 6.8951
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_04535D371.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.22.9e-32127184259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+ver+++dp+vv++tYeg+H h+
  Traes_2DL_04535D371.1 127 EDGYRWRKYGQKAVKNSPFPRSYYRCTNNKCTVKKRVERCSDDPSVVITTYEGQHCHH 184
                            8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-33111185IPR003657WRKY domain
SuperFamilySSF1182903.53E-28118184IPR003657WRKY domain
PROSITE profilePS5081129.149121186IPR003657WRKY domain
SMARTSM007743.0E-38126185IPR003657WRKY domain
PfamPF031061.4E-25127184IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MAGVECGGGD WPFSAEEAYA DSSALLAEIG WAAGFVDDGC AGELLPPLDP PPATPTGSME  60
GAGASSSSTD DGATREAADA DGRPAAATEA ASKPAPALAP GKTMKKQKRA RQPRFAFMTK  120
TEIDHLEDGY RWRKYGQKAV KNSPFPRSYY RCTNNKCTVK KRVERCSDDP SVVITTYEGQ  180
HCHHTVTFPR GAGAATLASQ MAFSAHHHHL MYNDLPALHS PTTQNPLFSV PAMSSSLLQP  240
LHCNRQELQL ASYTTQASSI SSPGSVPAVD KGLLDDMVPP AMRHG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-25116183774Probable WRKY transcription factor 4
2lex_A3e-25116183774Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU0586086e-69KU058608.1 UNVERIFIED: Panicum miliaceum WRKY8-like gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658215.11e-101PREDICTED: probable WRKY transcription factor 57
SwissprotQ9C9832e-56WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLW5BQN70.0W5BQN7_WHEAT; Uncharacterized protein
STRINGMLOC_58026.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.22e-55WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]